Clinical Chemistry
HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     


Clinical Chemistry 52: 1045-1053, 2006. First published March 30, 2006; 10.1373/clinchem.2005.065722
This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow 065722.Supplemental data
Right arrow All Versions of this Article:
clinchem.2005.065722v1
clinchem.2005.065722v2
52/6/1045    most recent
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in Web of Science
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Web of Science (21)
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Song, J.
Right arrow Articles by Zhang, Z.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Song, J.
Right arrow Articles by Zhang, Z.
Related Collections
Right arrow Cancer Diagnostics (since 2002)
Right arrow Proteomics and Protein Markers
(Clinical Chemistry. 2006;52:1045-1053.)
© 2006 American Association for Clinical Chemistry, Inc.


Proteomics and Protein Markers

Quantification of Fragments of Human Serum Inter-{alpha}-Trypsin Inhibitor Heavy Chain 4 by a Surface-Enhanced Laser Desorption/Ionization-Based Immunoassay

Jin Song1, Manisha Patel1, C. Nicole Rosenzweig1, Yee Chan-Li1, Lori J. Sokoll1, Eric T. Fung2, Nam-Ho Choi-Miura3, Michael Goggins4, Daniel W. Chan1 and Zhen Zhang1,a

1 Center for Biomarker Discovery, Department of Pathology, and4 Department of Pathology, Johns Hopkins Medical Institutions, Baltimore, MD.
2 Ciphergen Biosystems, Fremont, CA.
3 Department of Physiological Chemistry, School of Pharmaceutical Sciences, Showa University, Shinagawa, Tokyo, Japan.

aAddress correspondence to this author at: Department of Pathology, Johns Hopkins Medical Institutions, 419 N. Caroline St., Baltimore, MD 21231. Fax 410-502-7882; e-mail zzhang7{at}jhmi.edu.


   Abstract
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References
 
Background: Several proteolytically derived fragments from the proline-rich region (PRR) of human inter-{alpha}-trypsin inhibitor heavy chain 4 (ITIH4) have been identified by surface-enhanced or matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (SELDI-TOF-MS or MALDI-TOF-MS) as potential disease markers.

Methods: Previously, we developed a SELDI-based immunoassay that can simultaneously distinguish and quantify multiple isoforms/variants of a protein/peptide of interest. In this study, we used this high-throughput approach to quantify and characterize the extensive fragmentation within the PRR of human serum ITIH4 and determined its association with different disease conditions. The ITIH4-related fragments were first immunocaptured by use of beads coupled with peptide-specific antibodies. The eluates were then studied by SELDI-TOF-MS. In addition, freshly collected and immediately processed serum and plasma samples were used to analyze the ex vivo stability of these ITIH4 fragments.

Results: Human serum ITIH4 was shown to be extensively proteolytically processed within the PRR, and its fragmentation patterns were closely associated with different disease conditions. Fragmentation patterns were generally consistent with cleavages by endoprotease followed by exoprotease actions. Observed fragments changed little under different assay conditions or blood collection and processing procedures.

Conclusions: The fragmentation patterns within the PRR of human serum ITIH4 are associated with different disease conditions and may hold important diagnostic information. These fragmentation patterns could be useful as potential biomarkers for detection and classification of cancer.


   Introduction
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References
 
Inter-{alpha}-trypsin inhibitor heavy chain 4 (ITIH4) 1 is a plasma glycoprotein with a relative molecular mass of 120 000 that is expressed mainly in liver and that acts as an acute-phase protein in several species (1)(2)(3)(4)(5)(6)(7)(8)(9)(10)(11). Unlike other members of the inter-{alpha}-trypsin inhibitor family (12)(13), ITIH4 is present in plasma as a single-chain protein because its COOH terminus lacks the consensus sequence (DPHFII) for bikunin assembly through the glycosaminoglycan bridges (2)(3)(12)(13)(14). The COOH terminus of human ITIH4 contains a proline-rich region (PRR; Gly611–Gln730; GenBank accession no. Q14624) that is ~120 residues in length and harbors species- and tissue-specific domains (2)(4)(15). ITIH4 is highly sensitive to plasma kallikrein and has been proposed to be a potential precursor for plasma kallikrein-induced bioactive peptides (1)(2). ITIH4 is readily cleaved to the N-terminal Mr 85 000 and the C-terminal Mr 35 000 fragments by plasma kallikrein. The N-terminal Mr 85 000 fragment is further cleaved to the N-terminal Mr 57 000 fragment and a putative Mr 28 000 fragment (1)(3). However, the putative Mr 28 000 fragment that covers 65% of the PRR has hitherto not been detected, suggesting that it in turn is rapidly cleaved into unidentified smaller fragments (Fig. 1A ). The exact biological function of ITIH4 in vivo remains unclear.


Figure 1
View larger version (15K):
[in this window]
[in a new window]
 
Figure 1. Fragmentation of human ITIH4.

(A), model for the limited cleavage of human ITIH4. The dashed boxes represent the uncharacterized fragments. (B), PRR of ITIH4 (Gly611–Gln730) is indicated by filled arrows. The 30-residue domain Gly621–Gln650 may be an alternative splicing domain. The sequence of Pro662–Arg688 is proposed as a potentially (bradykinin-like) bioactive peptide domain. The underlined sequences are identified fragments within the PRR of ITIH4. The sequences in bold are the antigenic peptides used for antibody preparations.

A cleavage fragment of ITIH4 from serum proteomic analysis is a candidate biomarker for detecting early-stage ovarian cancer (16). The fragment m/z 3272 (Met658–Phe687) falls in the same domain as the proposed kallikrein-released, bradykinin-like fragment (Pro662–Arg688) within the PRR. Preliminary analysis using a surface-enhanced laser desorption/ionization time-of-flight mass spectrometry (SELDI-TOF-MS)–based immunoassay showed that this fragment was processed differently in the sera of patients with certain types of cancer (17). The identified fragments might indicate different proteolytic processing of ITIH4 in disease.

Conventional immunoassays often cannot distinguish a parent protein from its cleaved fragments, although the latter could possess the greater diagnostic potential. Previously, we developed a SELDI-based immunoassay to examine the significance of the presence and quantitative changes of specific fragments of human serum ITIH4 (17). This method consists of 2 steps: immunocapture followed by ProteinChip array assay. In this study, we used this high-throughput approach to quantify and characterize the extensive fragmentation of human serum ITIH4 within the PRR and to further explore its association with different disease conditions.


   Materials and Methods
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References
 
patient specimens
After receipt of institutional approval, we studied 178 serum specimens archived at the Johns Hopkins Medical Institutions and different from those studied previously (17). Specimens were from 40 healthy women [mean (SD) age, 42 (7) years]; 40 patients with stage III or IV (23 and 17 cases, respectively) ovarian cancer [56 (14) years]; groups of 19 patients each with stage 0, I, II, or III (3, 5, 8, and 3 cases, respectively) breast cancer [54 (15) years] or stage I, II, or III (1, 10, and 8 cases, respectively) colon cancer [69 (16) years]; and groups of 20 patients each with stage I, II, or III (1, 12, and 7 cases, respectively) prostate [58 (8) years], stage II or III (4 and 16 cases, respectively) pancreatic cancer [66 (8) years], or diabetes [52 (18) years]. All patients with breast, colon, or pancreatic cancer and diabetes were female. All serum samples had been processed promptly after collection and stored at –70 °C. Additionally, 3 pairs of plasma and serum samples from 3 patients with stage III or IV ovarian cancer [57 (13) years] and 1 serum sample from a healthy control were freshly collected and immediately processed. BD Plus Plastic dipotassium EDTA tubes were used for plasma preparation. All specimens were obtained before treatment and before surgery.

antibodies to human itih4
The 3 peptide antibodies (designated H4NT, H4CT, and H4CT-S) against human ITIH4 fragments were prepared by SynPep. For H4NT, a peptide was chemically synthesized as CKIPKPEASFSPR (see Fig. 1BUp ). For H4CT, a peptide was synthesized as CMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF (17). For H4CT-S, a shorter peptide than that of H4CT was synthesized as CLGLPGPPDVPDH. All synthesized peptides had cysteine at the NH2 terminus, were conjugated to keyhole limpet hemocyanin, and were injected into rabbits according to a 69-day standard protocol used by SynPep. All peptide antibodies above were purified by both protein-A and affinity chromatography (Pierce Biotechnology). Both anti-ITIH4 rabbit antiserum (antiserum) and anti-ITIH4 mouse monoclonal antibody (1A4) were prepared by Dr. N.H. Choi-Miura (3)(5). Antibody 1A4 recognizes an epitope located on the C-terminal Mr 35 000 fragment of ITIH4.

sodium dodecyl sulfate–polyacrylamide gel electrophoresis and immunoblot analysis
Human serum samples from cancer or noncancer patients were diluted 40-fold in 1x phosphate-buffered saline (pH 7.4, 5.60 mmol/L Na2HOP4, 1.06 mmol/L KH2PO4, 154.0 mmol/L NaCl in culture-grade water) with 1x protease inhibitor cocktail (Roche). Each sample was incubated with U9 buffer (9 mol/L urea–20 g/L CHAPS–50 mmol/L Tris-HCl; 2 volumes of sample per 3 volumes of U9 buffer) for 30 min at 4 °C. The mixture was then heated for 5 min at 95 °C. The denatured samples were electrophoresed on 4%–15% sodium dodecyl sulfate–polyacrylamide gel electrophoresis (SDS-PAGE) gels, electroblotted on nitrocellulose membranes, and probed with the H4NT, H4CT, H4CT-S, antiserum, and 1A4 antibodies, respectively. The bound antibodies were visualized with horseradish peroxidase–conjugated secondary antibodies and enhanced chemiluminescence (Amersham Biosciences).

seldi-based immunoassays
SELDI-based immunoassays were performed as described previously with modification (17). This method consists of 2 steps: immunocapture followed by ProteinChip array assay (see the Methods in the Data Supplement that accompanies the online version of this article at http://www.clinchem.org/content/vol52/issue6). All immunocaptures were carried out in 96-well filter plates (Nalge Nunc International), and all ProteinChip array incubations were performed in 96-well bioprocessors (Ciphergen). All procedures, including sample dispensing, washing, and matrix application except for bead distribution, were performed by Biomek 2000 robots (Beckman Coulter Inc.). Both immunocaptures and ProteinChip array incubations were run in duplicate for each patient. Eluates of each individual patient sample were pooled before splitting in the next step. Placement of samples in the 96-well filter plates and 96-well bioprocessors was randomized. A mixture of serum samples containing known peptides or proteins was used as calibrator and quality-control samples throughout the experiment and accounted for 7%–8% of the total samples processed.

itih4 fragmentation stability assay
To test the stability of fragmentation under different assay conditions, we examined 3 factors during the immunocaptures: the effect of protease inhibitors (with vs without protease inhibitor), incubation temperature (room temperature vs 4 °C), and duration of incubation (2 vs 4 h). To assess the stability of fragmentation subjected to different sample preprocessing procedures, we repeatedly froze/thawed the freshly collected serum samples 10 times and incubated them at room temperature for different durations (1 h, 3 h, and overnight) before performing the experiment. To determine the effect of clotting procedure on the fragmentation, we checked 3 pairs of freshly collected and processed plasma and serum samples. All procedures of the SELDI-based immunoassays were performed as described above.

data analysis
Mass spectral data preprocessing was performed with Ciphergen ProteinChip software, Ver. 3.2.1. Spectra were internally calibrated based on a few known peaks, including m/z 3272.6, and baseline-subtracted by use of a fitting window of 8 times the expected peak width. Univariate analysis was performed with the Mann–Whitney U-test for each pairwise comparison. Differences with P <0.01 were considered statistically significant. ROC curve analyses were performed to evaluate the diagnostic potential of the observed fragments. All statistical analyses were performed with Statistica 6.1 (Statsoft) and Analyze-it 1.71 (Analyze-It Software).

computational analyses of sequences
Bioinformatics tools at the Expert Protein Analysis System (ExPASy) proteomics server of the Swiss Institute of Bioinformatics (SIB) were used for protein sequence and structure analyses (http://us.expasy.org/). More specifically, the PeptideMass tool was used to calculate the theoretical masses of peptides generated by the chemical or enzymatic cleavage of human ITIH4 protein and to predict the putative cleavage sites with different enzymes or reagents; the ProtParam tool was used to compute the amino acid composition and instability indexes of generated peptides.


   Results
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References
 
sds-page and immunoblot analysis
All 3 peptide antibodies (H4NT, H4CT, and H4CT-S) recognized the Mr 120 000 intact protein and the Mr 85 000 fragment, antiserum recognized the Mr 120 000 protein and the Mr 85 000 and 57 000 fragments, and 1A4 antibody recognized the Mr 120 000 protein and the Mr 35 000 fragment. This approach enabled ready detection of the initial cleavage of human serum ITIH4 from cancer or noncancer samples, showing different cleavage patterns in different individual samples (Fig. 2 ). The Mr 28 000 fragment was still undetectable even with more specific peptide antibodies, which agreed with previous observations (1)(3) and further underscored that this fragment may be rapidly cleaved into smaller fragments. However, the differences in ITIH4 cleavage patterns among different samples observed here need to be explored further in a much larger number of experiments.


Figure 2
View larger version (15K):
[in this window]
[in a new window]
 
Figure 2. SDS-PAGE and immunoblot analysis.

One set of representative data from several experiments demonstrating the different cleavage patterns of ITIH4 in different samples. For example, the Mr 85 000 and 35 000 fragments were detected in serum 2 (ovarian cancer), whereas only the intact Mr 120 000 protein was detected in serum 1 (healthy control). In contrast, the Mr 57 000 fragment was one of the major fragments in serum 3 (breast cancer), suggesting that there was more obvious cleavage of ITIH4 in this sample.

fragmentation within the prr of itih4
Because of the unique characteristic of the PRR of human ITIH4 and because all previous SELDI-TOF-MS or matrix-assisted laser desorption/ionization (MALDI)-TOF-MS–identified disease-associated fragments were derived from this region (16)(17)(18)(19), we were interested in further characterizing the fragmentation of ITIH4 within this region. Using a SELDI-based immunoassay, we quantitatively measured the relative abundance of the specific fragments of ITIH4 within the PRR. The SELDI-based immunoassay showed a linear quantitative response spanning a more than 16-fold difference in concentrations for a human serum specimen serially diluted in the binding buffer (see Fig. 1Up in the online Data Supplement). Although the epitopes recognized by H4NT and H4CT are very close (only 13 amino acid residues apart; see Fig. 1BUp ), the SELDI-based immunoassay using beads coupled with respective antibodies revealed completely different spectra within the preferred mass range from the same serum sample (see top panel of Fig. 3A ). When we used H4CT, we detected not only the antigenic peptide (m/z 3273) but also a series of larger and smaller peptides with a potential C-terminal cleavage and a "sequential" N-terminal truncation (see Table 1 and the top panel of Fig. 3A ). This cleavage site suggested by our data matched the proposed first cleavage site of ITIH4 (Arg688–Arg689), which splits the intact protein into Mr 85 000 and 35 000 fragments (2)(14). All of these identified antigenic peptide-related fragments were located in the same domain of the kallikrein-released, bradykinin-like fragment (Pro662–Arg688). In contrast, when we used H4NT, we detected only 1 major peptide (m/z 3157) without any obvious further truncation as above, indicating that this fragment is more stable than fragments recognized by H4CT (see Table 1 and the top panel of Fig. 3A ). This fragment was located in a domain with potential alternative splicing (missing Gly621–Gln650), derived from the longer variant form (isoform 1) of human ITIH4 (4). These heterogeneous spectra indicated that Asn615–Arg616 and Arg644–Arg645 are preferential cleavage sites within the PRR of ITIH4, which is consistent with cleavage sites predicted by computational analyses (trypsin/chymotrypsin cleavages; data not shown). In addition, either with or without serum denaturation, H4CT-S recognized fragments different from those detected by H4CT (Fig. 3B ), which suggested that there might be a conformational folding within this range that partially blocks the epitope recognized by H4CT-S.


Figure 3
View larger version (56K):
[in this window]
[in a new window]
 
Figure 3. Fragmentation within the PRR of ITIH4.

A SELDI-based immunoassay was used to study the fragmentation within the PRR of human serum ITIH4. (A), top panel, use of beads coupled with different peptide antibodies (H4CT or H4NT) gave completely different spectra from same serum sample; bottom panel, overall spectrum obtained after pooling of beads coupled with different antibodies. The pooled beads were used in the large-scale experiment to study the association between the fragmentation within the PRR of ITIH4 and different disease conditions. (B), top panel, without incubation of serum with U9, H4CT-S recognized only a few fragments close to the COOH terminus of the antigenic peptide of H4CT; bottom panel, after incubation of serum with U9, H4CT-S recognized the same fragments recognized by H4CT. Profiles are shown in gel view (top of each panel) and peak display (bottom of each panel) mode, respectively.


View this table:
[in this window]
[in a new window]
 
Table 1. Association between fragmentation within the PRR of ITIH4 and disease conditions.1

Using the SELDI-based immunoassay, we also tested the stability of the observed fragmentation within the PRR of ITIH4. We first examined the fragmentation pattern of ITIH4 under different assay conditions (Fig. 4A ). The experimental data revealed that the addition of protease inhibitors had no obvious effect on the intensity and pattern of fragmentation. A longer incubation did decrease the overall intensity but did not alter the pattern of fragmentation. Incubation at room temperature gave slightly lower intensity than incubation at 4 °C but had no effect on the overall pattern of fragmentation. We next evaluated the fragmentation pattern of ITIH4 subjected to different sample preprocessing procedures (Fig. 4B ). Repeated freezing/thawing of the freshly collected serum samples (10 times) and incubation of the same sera at room temperature for different durations (1 h, 3 h, and overnight) before experiments had no obvious effect on the intensity and pattern of fragmentation. Notably, neither immunoblot analysis nor SELDI-based immunoassay detected any cleavage or truncation from the intact Mr 120 000 protein in the freshly collected serum from a healthy control (serum 1) subjected to these procedures (data not shown). Finally, we compared the overall fragmentation patterns of ITIH4, using 3 pairs of freshly collected and processed plasma and serum samples (data not shown). The experimental results showed that there were no obvious alterations of intensity and pattern of fragmentation related to the clotting procedure. These data suggest that the observed fragmentation within the PRR of ITIH4 occurred mainly in vivo with negligible influence, if any, from the assay process, different sample preprocessing procedures, or the clotting procedure.


Figure 4
View larger version (28K):
[in this window]
[in a new window]
 
Figure 4. ITIH4 fragmentation stability assay.

A SELDI-based immunoassay was used to examine the fragmentation within the PRR of ITIH4 under different assay conditions (A) and after different sample preprocessing procedures (B). The spectra acquired from a different serum sample by use of the same antibody-coupled beads or beads without coupled antibody are included here as a positive (+Ctr) and negative control (–Ctr). RT, room temperature; –PI, without protease inhibitors; +PI, with protease inhibitors; F/T, freezing/thawing.

association between fragmentation within the prr of itih4 and disease conditions
To determine the association of fragmentation within the PRR of ITIH4 with different disease conditions, we used the SELDI-based immunoassay to analyze 178 human serum specimens. The representative overall spectrum acquired by use of pooled beads coupled with H4CT or H4NT is given in the bottom panel of Fig. 3AUp . Scatter plots of intensity values obtained with the SELDI-based immunoassay for each of identified ITIH4 fragments across samples from patients with ovarian, breast, colon, prostate, or pancreatic cancer and diabetes as well as from healthy controls are shown in Fig. 2Up of the online Data Supplement. The data presented in Table 1Up further demonstrate that the fragmentation within the PRR of ITIH4 is indeed associated with different disease conditions. Some fragments were significantly increased or decreased in patients with different diseases, but not in colon cancer. Different diseases also showed different fragmentation patterns. For example, one or all of the fragments recognized by H4CT were significantly decreased in ovarian and pancreatic cancer, whereas several fragments recognized by H4CT were significantly increased in breast and prostate cancer and diabetes. The m/z 3156.6 fragment recognized by H4NT was significantly decreased in pancreatic cancer, whereas it was significantly increased in prostate cancer. ROC analysis results (Table 1Up ) indicated that most of these fragments demonstrated a noticeable power for disease detection even within this relatively small set of specimens.


   Discussion
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References
 
The developed SELDI-based immunoassay can simultaneously distinguish and quantify multiple isoforms/variants of a particular protein/peptide (17). This method could not only determine which specific combination of posttranslationally processed forms of discovered biomarkers confers better detection accuracy, but also provided insights for their biological relevance in disease progression. We found that human serum ITIH4 was extensively processed proteolytically within the PRR and that the fragmentation patterns within this region were closely associated with different disease conditions. Some fragments were significantly increased or decreased in samples from patients with different diseases. Different diseases showed different fragmentation patterns. Consistent with our results, a panel of disease-associated fragments identified by SELDI-TOF-MS or MALDI-TOF-MS have been shown to be cleaved from the same region (PRR) of human ITIH4 (16)(17)(18)(19)(20). Some of these fragments exactly match with partial fragments identified in this study. In contrast to our study using a SELDI-based immunoassay, most of these human ITIH4 fragments were identified by either plasma or serum protein/peptide profiling using a combination of protein fractionation, SELDI or MALDI, and tandem MS approaches (16)(18)(19)(20). Some of these fragments were also found to be associated with prostate, bladder, and breast cancers (20), with melanoma and breast cancer (18), or with pancreatic cancer (19). It has been proposed that proteolytic processing patterns in the serum peptidome hold important information that may have direct clinical utility as a surrogate marker for detection and classification of cancer (17)(20). Taken together, the experimental results from the above and other reports show the possibility of specifically combining the differential processed forms of ITIH4 into a multivariate predictive model to achieve higher accuracy for cancer detection and classification.

Because of the extreme susceptibility of ITIH4 to plasma kallikrein and the partial homology of the amino acid sequence to that of bradykinin released from high–molecular-mass kininogen by plasma kallikrein, human ITIH4 had been proposed to be a potential precursor of bioactive peptides (1)(2). However, how these fragments are further cleaved, which protease(s) are directly responsible for their cleavages, and the putative biological activity of bioactive peptide(s) remain to be determined experimentally. The identification of disease-associated fragments within the PRR of human ITIH4 by SELDI- or MALDI-based platforms is undoubtedly providing some important insights into these interesting issues. Our study revealed frequent cleavages/truncations in the "bradykinin-like domain", but few events in the "alternative splicing domain", consistent with the primary structure analyses obtained with the ProtParam tool, which classified the former as an unstable form and the latter as a stable form (data not shown). Similar truncation frequencies of fragments derived from these 2 domains of ITIH4 in human serum (20) and plasma (21) have been described. Some of these fragments may be bioactive peptide(s)/propeptide(s), and others are seemingly random internal fragments. However, the cleavage/truncation patterns were generally consistent with those initial cleavages by trypsin/chymotrypsin-like serine proteases (e.g., kallikreins) followed by subsequent terminal truncations resulting from aminopeptidase and carboxypeptidase activities. Similar 2-step proteolytic processes (endoprotease followed by exoprotease) that generate the most abundant layer of the serum/plasma peptidome have also been described (17)(20)(21). In addition, exoproteases play an important role in the regulation of bioactive peptides (22)(23)(24)(25)(26)(27). For example, some regulatory peptides are metabolized/modulated by membrane-bound peptidases such as dipeptidyl peptidase IV (DPPIV or CD26) and angiotensin-converting enzyme (22)(23)(24)(25). However, a thorough assessment of the biological activity of the peptides identified in this study demands extensive research in vitro and in vivo.

A key question is whether these identified fragments or fragmentation patterns represent valuable biomarkers or nonspecific epiphenomena (21)(28). Related questions include (a) Is serum suitable for this kind of experiment, with the possibility that the proteases activated during the clotting process alter the existing biologically relevant fragmentation patterns? (b) How should samples be collected and processed? (c) Is it necessary to block the inherent enzymatic activity at the time of sample collection and during the course of assays? The identified disease-associated fragments of human ITIH4 from serum were also observed in plasma, which suggested that the primary fragmentation of ITIH4 was not related solely to clotting (18)(19)(21). Exoprotease activities superimposed on the ex vivo coagulation and complement-degradation pathways contribute to generation of not only cancer-specific but also cancer-type–specific serum peptides (20). In this study, through the pairwise comparisons of freshly collected and immediately processed serum and plasma samples from individual patients, we saw no obvious alterations of fragmentation patterns of ITIH4 related to clotting. Moreover, once fragments were formed, they changed little under different assay conditions or when subjected to different sample preprocessing procedures. These results indicated that the observed fragmentations within the PRR of ITIH4 occurred mainly in vivo, not ex vivo. It is generally thought that use of protease inhibitors during sample collection will be necessary to asses whether ex vivo proteolytic activity contributes to the observed alterations (17)(21)(29), but not all agree (20). In our experiments, protease inhibitor cocktail was used to block the inherent enzymatic activity and minimize background experimental variation from ex vivo proteolytic activity.

Proteases have been extensively implicated in the development and progression of cancer (30)(31). The proteolytic processing of high-abundance host-response proteins actually amplifies the signal of potentially low-abundance biologically active disease markers such as proteases. Therefore, one may expect to find the more convenient and reliable blood protein(s)/peptide(s) that simply serve as an endogenous substrate pool for proteases as surrogate markers for detection and classification of cancer. The fragmentation within the PRR of human ITIH4 might be such a case. However, how the proteases may contribute mechanistically to the observed differences in the fragmentation patterns of human serum ITIH4 among the different disease conditions remains unanswered. In this study, the overall significant decrease in ITIH4 fragments in pancreatic cancer suggested that the fragmentation pattern of human ITIH4 might be a good candidate biomarker for this disease. Consistent with our result, one cleavage fragment within the PRR, derived from the shorter variant form (isoform 2) of human ITIH4, was also found to be decreased in pancreatic cancer (19). The m/z 2358 fragment was significantly increased in breast cancer and the m/z 3272, 2724, 2358, and 3156 fragments were significantly increased in prostate cancer, which are in good agreement with the results reported by Villanueva et al. (20) and our preliminary analysis (17). Previously, the m/z 3272 fragment was identified as a candidate biomarker (up-regulated) for detecting early-stage ovarian cancer (16). In this study, this up-regulation was not observed in late-stage ovarian cancers. This could be an indication that the fragmentation within the PRR of ITIH4 is related to the stage of this disease. We confirmed the down-regulation of the m/z 2627 fragment in late-stage ovarian cancers (17). Two fragments, m/z 3141 and 2358, were significantly increased in diabetes. Some identified disease-associated fragments in specific disease groups (17)(20) were not validated in this experiment. ROC analyses demonstrated the potential diagnostic value of these fragments. Assessment of diagnostic accuracy will require large-scale studies. SELDI and MALDI have limitations for biomarker discovery (21)(28). Discovery of truly disease-associated biomarkers also requires standardized sample collection and handling protocols, statistically sound study designs, and appropriate study populations selected based on clearly defined clinical utility. Furthermore, technology development for high-throughput sample preparation with low analytical variability is also critically needed to allow for the analysis of subproteomes of complex specimens (32).

In conclusion, in this study, we further quantified and characterized the fragmentation within the PRR of human ITIH4 and demonstrated the associations of the fragmentation of ITIH4 with different disease conditions. Our experimental results suggested that proteolytic processing patterns of human serum ITIH4 hold important diagnostic information that could be used as biomarkers for detection and classification of cancer.


   Acknowledgments
 
This research was partially supported by funding from the Department of Defense (DAMD17-OC03-IDEA), the NIH/NCI Early Detection Research Network (CA115102-01) and Specialized Programs of Research Excellence (SPORE) in Ovarian Cancer (1P50 CA83639) and in Gastrointestinal Cancer (CA62924), and Ciphergen Biosystems, Inc.


   Footnotes
 
1 Nonstandard abbreviations: ITIH4, inter-{alpha}-trypsin inhibitor heavy chain 4; PRR, proline-rich region; SELDI-TOF-MS, surface-enhanced laser desorption/ionization time-of-flight mass spectrometry; SDS-PAGE, sodium dodecyl sulfate–polyacrylamide gel electrophoresis; and MALDI, matrix-assisted laser desorption/ionization.


   References
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References
 

  1. Pu XP, Iwamoto A, Nishimura H, Nagasawa S. Purification and characterization of a novel substrate for plasma kallikrein (PK-120) in human plasma. Biochim Biophys Acta 1994;1208:338-343.[CrossRef][Medline] [Order article via Infotrieve]
  2. Nishimura H, Kakizaki I, Muta T, Sasaki N, Pu PX, Yamashita T, et al. cDNA and deduced amino acid sequence of human PK-120, a plasma kallikrein-sensitive glycoprotein. FEBS Lett 1995;357:207-211.[CrossRef][Web of Science][Medline] [Order article via Infotrieve]
  3. Choi-Miura NH, Sano Y, Oda E, Nakano Y, Tobe T, Yanagishita T, et al. Purification and characterization of a novel glycoprotein which has significant homology to heavy chains of inter-{alpha}-trypsin inhibitor family from human plasma. J Biochem (Tokyo) 1995;117:400-407.[Abstract/Free Full Text]
  4. Soury E, Olivier E, Daveau M, Hiron M, Claeyssens S, Risler JL, et al. The H4P heavy chain of inter-{alpha}-inhibitor family largely differs in the structure and synthesis of its prolin-rich region from rat to human. Biochem Biophys Res Commun 1998;243:522-530.[CrossRef][Web of Science][Medline] [Order article via Infotrieve]
  5. Choi-Miura NH. Quantitative measurement of the novel human plasma protein, IHRP, by sandwich ELISA. Biol Pharm Bull 2001;24:214-217.[CrossRef][Web of Science][Medline] [Order article via Infotrieve]
  6. Choi-Miura NH, Takahashi K, Yoda M, Saito K, Hori M, Ozaki H, et al. The novel acute phase protein, IHRP, inhibits actin polymerization and phagocytosis of polymorphonuclear cells. Inflamm Res 2000;49:305-310.[CrossRef][Medline] [Order article via Infotrieve]
  7. Daveau M, Jean L, Soury E, Olivier E, Masson S, Lyoumi S, et al. Hepatic and extra-hepatic transcription of inter-{alpha}-inhibitor family genes under normal or acute inflammatory conditions in rat. Arch Biochem Biophys 1998;350:315-323.[CrossRef][Web of Science][Medline] [Order article via Infotrieve]
  8. Gonzalez-Ramon N, Hoebe K, Alava MA, Van Leengoed L, Pineiro M, Carmona S, et al. Pig MAP/ITIH4 and haptoglobin are interleukin-6-dependent acute-phase plasma proteins in porcine primary cultured hepatocytes. Eur J Biochem 2000;267:1878-1885.[Medline] [Order article via Infotrieve]
  9. Gonzalez-Ramon N, Alava MA, Sarsa JA, Pineiro M, Escartin A, Garcia-Gil A, et al. The major acute phase serum protein in pigs is homologous to human plasma kallikrein sensitive PK-120. FEBS Lett 1995;371:227-230.[CrossRef][Medline] [Order article via Infotrieve]
  10. Pineiro M, Andres M, Iturralde M, Carmona S, Hirvonen J, Pyorala S, et al. ITIH4 (inter-{alpha}-trypsin inhibitor heavy chain 4) is a new acute-phase protein isolated from cattle during experimental infection. Infect Immun 2004;72:3777-3782.[Abstract/Free Full Text]
  11. Pineiro M, Alava MA, Gonzalez-Ramon N, Osada J, Lasierra P, Larrad L, et al. ITIH4 serum concentration increases during acute-phase processes in human patients and is up-regulated by interleukin-6 in hepatocarcinoma HepG2 cells. Biochem Biophys Res Commun 1999;263:224-229.[CrossRef][Web of Science][Medline] [Order article via Infotrieve]
  12. Salier JP, Rouet P, Raguenez G, Daveau M. The inter-{alpha}-inhibitor family: from structure to regulation. Biochem J 1996;315(Pt 1):1-9.
  13. Bost F, Diarra-Mehrpour M, Martin JP. Inter-{alpha}-trypsin inhibitor proteoglycan family—a group of proteins binding and stabilizing the extracellular matrix. Eur J Biochem 1998;252:339-346.[Web of Science][Medline] [Order article via Infotrieve]
  14. Saguchi K, Tobe T, Hashimoto K, Sano Y, Nakano Y, Miura NH, et al. Cloning and characterization of cDNA for inter-{alpha}-trypsin inhibitor family heavy chain-related protein (IHRP), a novel human plasma glycoprotein. J Biochem (Tokyo) 1995;117:14-18.[Abstract/Free Full Text]
  15. Hashimoto K, Tobe T, Sumiya J, Sano Y, Choi-Miura NH, Ozawa A, et al. Primary structure of the pig homologue of human IHRP: inter-{alpha}-trypsin inhibitor family heavy chain-related protein. J Biochem (Tokyo) 1996;119:577-584.[Abstract/Free Full Text]
  16. Zhang Z, Bast RCJ, Yu Y, Li J, Sokoll LJ, Rai AJ, et al. Three biomarkers identified from serum proteomic analysis for the detection of early stage ovarian cancer. Cancer Res 2004;64:5882-5890.[Abstract/Free Full Text]
  17. Fung ET, Yip TT, Lomas L, Wang Z, Yip C, Meng XY, et al. Classification of cancer types by measuring variants of host response proteins using SELDI serum assays. Int J Cancer 2005;115:783-789.[CrossRef][Web of Science][Medline] [Order article via Infotrieve]
  18. Caputo E, Lombardi ML, Luongo V, Moharram R, Tornatore P, Pirozzi G, et al. Peptide profiling in epithelial tumor plasma by the emerging proteomic techniques. J Chromatogr B Analyt Technol Biomed Life Sci 2005;819:59-66.[Medline] [Order article via Infotrieve]
  19. Koomen JM, Shih LN, Coombes KR, Li D, Xiao LC, Fidler IJ, et al. Plasma protein profiling for diagnosis of pancreatic cancer reveals the presence of host response proteins. Clin Cancer Res 2005;11:1110-1118.[Abstract/Free Full Text]
  20. Villanueva J, Shaffer DR, Philip J, Chaparro CA, Erdjument-Bromage H, Olshen AB, et al. Differential exoprotease activities confer tumor-specific serum peptidome patterns. J Clin Invest 2006;116:271-284.[CrossRef][Web of Science][Medline] [Order article via Infotrieve]
  21. Koomen JM, Li D, Xiao LC, Liu TC, Coombes KR, Abbruzzese J, et al. Direct tandem mass spectrometry reveals limitations in protein profiling experiments for plasma biomarker discovery. J Proteome Res 2005;4:972-981.[CrossRef][Web of Science][Medline] [Order article via Infotrieve]
  22. Busek P, Malik R, Sedo A. Dipeptidyl peptidase IV activity and/or structure homologues (DASH) and their substrates in cancer. Int J Biochem Cell Biol 2004;36:408-421.[CrossRef][Medline] [Order article via Infotrieve]
  23. Proost P, De Meester I, Schols D, Struyf S, Lambeir AM, Wuyts A, et al. Amino-terminal truncation of chemokines by CD26/dipeptidyl-peptidase IV. Conversion of RANTES into a potent inhibitor of monocyte chemotaxis and HIV-1-infection. J Biol Chem 1998;273:7222-7227.[Abstract/Free Full Text]
  24. Walsh DA, Mapp PI, Wharton J, Polak JM, Blake DR. Neuropeptide degrading enzymes in normal and inflamed human synovium. Am J Pathol 1993;142:1610-1621.[Abstract]
  25. Juillerat-Jeanneret L, Aubert JD, Leuenberger P. Peptidases in human bronchoalveolar lining fluid, macrophages, and epithelial cells: dipeptidyl (amino)peptidase IV, aminopeptidase N, and dipeptidyl (carboxy)peptidase (angiotensin-converting enzyme). J Lab Clin Med 1997;130:603-614.[CrossRef][Web of Science][Medline] [Order article via Infotrieve]
  26. Joseph K, Kaplan AP. Formation of bradykinin: a major contributor to the innate inflammatory response. Adv Immunol 2005;86:159-208.[CrossRef][Web of Science][Medline] [Order article via Infotrieve]
  27. Lefebvre J, Murphey LJ, Hartert TV, Jiao Shan R, Simmons WH, Brown NJ. Dipeptidyl peptidase IV activity in patients with ACE-inhibitor-associated angioedema. Hypertension 2002;39:460-464.[Abstract/Free Full Text]
  28. Diamandis EP. Mass spectrometry as a diagnostic and a cancer biomarker discovery tool: opportunities and potential limitations. Mol Cell Proteomics 2004;3:367-378.[Abstract/Free Full Text]
  29. Corlin DB, Sen JW, Ladefoged S, Lund GB, Nissen MH, Heegaard NH. Quantification of cleaved ß2-microglobulin in serum from patients undergoing chronic hemodialysis. Clin Chem 2005;51:1177-1184.[Abstract/Free Full Text]
  30. Matrisian LM, Sledge GW, Jr, Mohla S. Extracellular proteolysis and cancer: meeting summary and future directions. Cancer Res 2003;63:6105-6109.[Abstract/Free Full Text]
  31. Bank U, Kruger S, Langner J, Roessner A. Review: peptidases and peptidase inhibitors in the pathogenesis of diseases. Disturbances in the ubiquitin-mediated proteolytic system. Protease-antiprotease imbalance in inflammatory reactions. Role of cathepsins in tumour progression. Adv Exp Med Biol 2000;477:349-378.[Web of Science][Medline] [Order article via Infotrieve]
  32. Zhang Z, Chan DW. Cancer proteomics: in pursuit of "true" biomarker discovery. Cancer Epidemiol Biomarkers Prev 2005;14:2283-2286.[Free Full Text]



The following articles in journals at HighWire Press have cited this article:


Home page
The Computer JournalHome page
A. Gammerman, V. Vovk, B. Burford, I. Nouretdinov, Z. Luo, A. Chervonenkis, M. Waterfield, R. Cramer, P. Tempst, J. Villanueva, et al.
Serum Proteomic Abnormality Predating Screen Detection of Ovarian Cancer
The Computer Journal, May 1, 2009; 52(3): 326 - 333.
[Abstract] [Full Text] [PDF]


Home page
Mol. Cell. ProteomicsHome page
J. M. Koomen, E. B. Haura, G. Bepler, R. Sutphen, E. R. Remily-Wood, K. Benson, M. Hussein, L. A. Hazlehurst, T. J. Yeatman, L. T. Hildreth, et al.
Proteomic Contributions to Personalized Cancer Care
Mol. Cell. Proteomics, October 1, 2008; 7(10): 1780 - 1794.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
Y. Tang, K. Kitisin, W. Jogunoori, C. Li, C.-X. Deng, S. C. Mueller, H. W. Ressom, A. Rashid, A. R. He, J. S. Mendelson, et al.
Progenitor/stem cells give rise to liver cancer due to aberrant TGF-{beta} and IL-6 signaling
PNAS, February 19, 2008; 105(7): 2445 - 2450.
[Abstract] [Full Text] [PDF]


Home page
Clin. Chem.Home page
L. A. Liotta and E. F. Petricoin
Putting the "Bio" back into Biomarkers: Orienting Proteomic Discovery toward Biology and away from the Measurement Platform
Clin. Chem., January 1, 2008; 54(1): 3 - 5.
[Full Text] [PDF]


Home page
Clin. Chem.Home page
M. J. Bennett
Untargeted Metabolomic Analysis Hits the Target
Clin. Chem., December 1, 2007; 53(12): 2037 - 2039.
[Full Text] [PDF]


Home page
Clin. Chem.Home page
J. F. Timms, E. Arslan-Low, A. Gentry-Maharaj, Z. Luo, D. T'Jampens, V. N. Podust, J. Ford, E. T. Fung, A. Gammerman, I. Jacobs, et al.
Preanalytic Influence of Sample Handling on SELDI-TOF Serum Protein Profiles
Clin. Chem., April 1, 2007; 53(4): 645 - 656.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow 065722.Supplemental data
Right arrow All Versions of this Article:
clinchem.2005.065722v1
clinchem.2005.065722v2
52/6/1045    most recent
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in Web of Science
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Web of Science (21)
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Song, J.
Right arrow Articles by Zhang, Z.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Song, J.
Right arrow Articles by Zhang, Z.
Related Collections
Right arrow Cancer Diagnostics (since 2002)
Right arrow Proteomics and Protein Markers


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS